Summary
Resource Type
MRNA Contig - polypeptide
Organism
Name
Fraxinus_pennsylvanica_120313_comp100093_c0_seq1
Identifier
Fraxinus_pennsylvanica_120313_comp100093_c0_seq1
Time Accessioned
Monday, May 21, 2018 - 11:35
Time Last Modified
Monday, May 21, 2018 - 11:35
Annotations
This record is associated with the following annotations.
TermDefinition
INTERPRO:IPR008889VQ
Cross Reference
There are no cross references.
InterPro results
The following InterPro results are available for this feature:
Analysis Name: Interpro Analysis of Green Ash (Fraxinus pennsylvanica)
Date Performed: 2016-04-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008889VQPFAMPF05678VQcoord: 94..114
e-value: 1.4E-4
score: 20.7

Location on Map
MapPositionMap Description
This are no positions on any maps.
Publication
Relationship
Relationship
The polypeptide, Fraxinus_pennsylvanica_120313_comp100093_c0_seq1_m.67338, derives from the mRNA_contig, Fraxinus_pennsylvanica_120313_comp100093_c0_seq1.
Sequences
mRNA Contig Sequence
TGATTTCACATGCATGAAGTAGTTAAATATATATAATCCATCAGAACCAT
CCGAAAATCATAAACAGTAATTAAGTACTACAACATGTACAAAACTTGAA
GGAGAGAAATCATAATAAGTATTAATTGTTACACAATTAAAAGGGATCTT
GGCGCTGGAACTGTTGATGCTGGTTGTTGTAAAAATATTGCTGATCTTGC
GCCTTATAACTCCGGCCAGAAACGAACTCCAATGGATTATTTCTTGTGGA
AATTAGACCATTGAGCTGCTGATGATCAGTAGCTGATGATGAGGAGGATC
CAAAACACAAAGTGATCGGCCCTCTCTGAGTGTGGCTGCAACCGGTGTGT
TTTTGCACTAGGGATCTAAAATTTGTTATGTGGGCATTCAGATAAGTCGT
CGGAGTTAGCCTCGAAGCTCTGGACCGCCTCCGTTTTGGAGTCCCCGGAC
TGGTTTTCGTCTTCAAATCACTCCCAGCTGTTGAACTTGAATTTTCTGGG
CTGTTACTTGTAACCACTACACTGTAATCAGGGTTGAATAGGTTTTCGTT
TATATCGAAATTAGTAGTTGACACCATCGTTGCATCGGAAAATTCGGGAC
AAGGCATGAAAAAGTCATCAATTAATATTGGTTCTTGGTAGTATTGTTCC
CACGGAGAAGAGCTTGGGACATGGTCACTCATGGTGGCTTTCGGTGGGTG
TTTTCTATAGCACTCCCTCTTAGCCCTTTTTAGCCTCTGATCATAGGAAG
AATACAACACCCTTTGCTAAAAACACACTCATATATATAGCGACAATCAA
TCAGAATAACAGGTTCCGATTTTCAAACCAGTCATGTCGCGTGCTTGCTG
ACCAGACCATTCATGTCATTGATATATATTTATAC
Sequence Length
885
Sequence Checksum
358b2de10d4f6aafbd34fc6631553d30
Protein Sequence
MSDHVPSSSPWEQYYQEPILIDDFFMPCPEFSDATMVSTTNFDINENLFN
PDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNA
HITNFRSLVQKHTGCSHTQRGPITLCFGSSSSSATDHQQLNGLISTRNNP
LEFVSGRSYKAQDQQYFYNNQHQQFQRQDPF*
Homology
The following BLAST results are available for this feature:
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. DB:swissprot:display
Analysis Date: 2016-04-25
Analysis Name: Green Ash (blastx against sprot)
Total hits: 1
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. DB:swissprot:display
Match: VQ22_ARATH (VQ motif-containing protein 22 OS=Arabidopsis thaliana GN=VQ22 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.815e-9
Identity = 36/92 (39.13%), Postives = 55/92 (59.78%), Query Frame = -3
              Query:  281 NPDYSVVVTSNSPENSSSTAG--SDLKTKTSPGT-----PKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGCSHTQRGPITLCFGSSSSSA 535 N  +    T+ S   +++TAG  + + ++ SP T     P RRRSRASR TPTT LN   +NFR++VQ++TG      GP  + FGS ++++
              Sbjct:   14 NQTFFTTSTTASTAVTTTTAGDTTSIDSRLSPETGRVTKPTRRRSRASRRTPTTLLNTDTSNFRAMVQQYTG------GPSAMAFGSGNTTS 99
            
Match NameStatsDescription
VQ22_ARATHE-Value: 1.815e-9, PID: 39.13VQ motif-containing protein 22 OS=Arabidopsis thal... [more]
back to top
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Analysis Date: 2016-04-25
Analysis Name: Green Ash (blastx against TrEMBL)
Total hits: 10
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: M5WK99_PRUPE (M5WK99_PRUPE)

HSP 1 Score: 75.0998 bits (183), Expect = 2.672e-14
Identity = 49/134 (36.57%), Postives = 62/134 (46.27%), Query Frame = -3
              Query:  296 VPSSSPWEQYYQEPILIDDFFMPC-PEFSDATMVSTTNFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGCSHT--------QRGPITLCFGS 670 +P S+ W QYYQ+  + +    P    FSDAT+V+T                              G  L    S   P RRRSR S+ TP T LNA+  NFR+LVQ+ TGC+ +        QRGPI L FGS
              Sbjct:    1 MPGSTEWGQYYQQAFMDNGQATPTNGGFSDATIVTTR----------------------------GGGQLTPTRSVSKPIRRRSRVSKKTPITLLNANANNFRALVQQFTGCATSSSPISFGNQRGPINLSFGS 106
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: G7INF7_MEDTR (G7INF7_MEDTR)

HSP 1 Score: 75.8702 bits (185), Expect = 4.627e-14
Identity = 53/134 (39.55%), Postives = 70/134 (52.24%), Query Frame = -3
              Query:  287 WEQYYQEPILIDDFFMPCP--EFSDATMVSTTNFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGC----------SHTQRGPITLCFGSSSS 652 W QYYQ+P L+D    P P   FSD+T+++T    +   + +P  S   TS+      +  G ++        P RRRSRAS+ TPTT LNA+ TNFR LVQ+ TGC              +GPITL F   SS
              Sbjct:   13 WMQYYQQP-LMDHTLNPPPIENFSDSTVMTTNPIPLETMILSPTNSYTNTSDQ----LTPKGGNI------SKPIRRRSRASKRTPTTLLNANTTNFRQLVQQFTGCPSTTLSSSSSLGVHKGPITLNFQQGSS 135
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: I3SJD8_MEDTR (I3SJD8_MEDTR)

HSP 1 Score: 73.9442 bits (180), Expect = 1.668e-13
Identity = 52/134 (38.81%), Postives = 69/134 (51.49%), Query Frame = -3
              Query:  287 WEQYYQEPILIDDFFMPCP--EFSDATMVSTTNFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGC----------SHTQRGPITLCFGSSSS 652 W QYYQ+P L+D    P P   FSD+T+++T    +   + +P  S   TS+      +  G ++        P RRRSRAS+ TPTT LNA+  NFR LVQ+ TGC              +GPITL F   SS
              Sbjct:   13 WMQYYQQP-LMDHTLNPPPIENFSDSTVMTTNPIPLETMILSPTNSYTNTSDQ----LTPKGGNI------SKPIRRRSRASKRTPTTLLNANTANFRQLVQQFTGCPSTTLSSSSSLGVHKGPITLNFQQGSS 135
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: M1AK30_SOLTU (M1AK30_SOLTU)

HSP 1 Score: 71.633 bits (174), Expect = 8.019e-13
Identity = 55/146 (37.67%), Postives = 74/146 (50.68%), Query Frame = -3
              Query:  245 YYQEPILIDDFFMPCPEFSDATMVSTT--NFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPK-----RRRSRASRLTPTTYLNAHITNFRSLVQKHTGC------SHTQRGPITLCFGSSSSSATDHQQLNGLIST 643 YYQ+   +++   P   FSD+T+ +T   N  I+ +  +  YS  ++ N           D+    SP T       RRRSRAS+ TPTT LNA ITNFR+LVQ+HTGC       + Q+GPI L FG       DH   N L  +
              Sbjct:   16 YYQQDFALEN--NPHEYFSDSTITTTNTQNMTIDHHHHH-QYSSRISEND----------DIHELISPKTTAIKPVTRRRSRASKKTPTTLLNASITNFRALVQQHTGCHTCPTFKNNQKGPINLSFG----PPNDHDDQNELFGS 144
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: B9MUN3_POPTR (B9MUN3_POPTR)

HSP 1 Score: 71.2478 bits (173), Expect = 1.507e-12
Identity = 56/137 (40.88%), Postives = 68/137 (49.64%), Query Frame = -3
              Query:  272 SSSPWEQYYQEPILIDDFFMPCPEFSDATMVSTTNFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGC------SHTQRGPITLCFGSSSSSATDH 664 SSS W Q Y E   I     P   FSDAT V+T+      ++ NP  S+         +SS     L  K     P +RRSRAS+ TP+T L A   NFR+LVQ+ TGC         Q+GPITL FG    SA DH
              Sbjct:    4 SSSDWVQLY-EQANIHGQATPSFGFSDATNVATSGA---SHIINPSSSI---------TSSAGDQTLTPKGCGSKPIKRRSRASKKTPSTLLTATTANFRALVQQFTGCPSNPISIGNQKGPITLNFG--LGSAQDH 125
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: A0A0B2QYJ0_GLYSO (A0A0B2QYJ0_GLYSO)

HSP 1 Score: 71.633 bits (174), Expect = 1.513e-12
Identity = 57/158 (36.08%), Postives = 77/158 (48.73%), Query Frame = -3
              Query:  206 WEQYYQEPILIDDFFMPCPEFSDATMVSTTNFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGCSHT-------QRGPITLCF--GSSSSSATDHQQLNGLISTRNNPLEFVSGRSY 652 W Q+YQ+P++         +     +   T            +S   T   P + S++  S L  K +   P RRRSRAS+ TPTT LNA+ TNFR+LVQ+ TGC  T        +GPITL F  GSSS+    H       +T +  +  VSGRSY
              Sbjct:   14 WMQFYQQPLMDSHGHDHDHDHDHHALAPNTT---------EGFSSSPTPTMPSSESNSILSQLSPKGNVSKPIRRRSRASKRTPTTLLNANPTNFRALVQQFTGCPRTTMSTLGVHKGPITLNFQQGSSSTEQKVHPH-----NTSSRVVLPVSGRSY 157
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: I1L165_SOYBN (I1L165_SOYBN)

HSP 1 Score: 71.2478 bits (173), Expect = 1.825e-12
Identity = 56/158 (35.44%), Postives = 77/158 (48.73%), Query Frame = -3
              Query:  206 WEQYYQEPILIDDFFMPCPEFSDATMVSTTNFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGCSHT-------QRGPITLCF--GSSSSSATDHQQLNGLISTRNNPLEFVSGRSY 652 W Q+YQ+P++         +     +   T            +S   T   P + S++  S L  K +   P RRRSRAS+ TPTT LNA+ TNFR+LVQ+ TGC  T        +GPITL F  G+SS+    H       +T +  +  VSGRSY
              Sbjct:    8 WMQFYQQPLMDSHGHDHDHDHDHHALAPNTT---------EGFSSSPTPTMPSSESNSILSQLSPKGNVSKPIRRRSRASKRTPTTLLNANPTNFRALVQQFTGCPRTTMSTLGVHKGPITLNFQQGNSSTEQKVHHH-----NTSSRVVLPVSGRSY 151
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: K4B7H9_SOLLC (K4B7H9_SOLLC)

HSP 1 Score: 69.707 bits (169), Expect = 1.827e-12
Identity = 37/67 (55.22%), Postives = 45/67 (67.16%), Query Frame = -3
              Query:  299 DLKTKTSPGT----PKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGC------SHTQRGPITLCFG 469 D+   TSP T    P RRRSR+S+ TPTT +NA ITNFR+LVQ+HTGC       + Q+GPI L FG
              Sbjct:   22 DIHELTSPKTTTMKPIRRRSRSSKKTPTTLVNASITNFRALVQQHTGCHTCPTFKNNQKGPINLSFG 88
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: K4B5E5_SOLLC (K4B5E5_SOLLC)

HSP 1 Score: 69.707 bits (169), Expect = 3.154e-12
Identity = 40/79 (50.63%), Postives = 53/79 (67.09%), Query Frame = -3
              Query:  281 SPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGCSHT-----QRGPITLCFGSSSSSA 502 SP+NS         TK++   P RRRSRAS+ TPTT +NA I+NFR++VQ++TGC HT     Q+GPI L FGS  +S+
              Sbjct:   68 SPDNSCG------DTKSASSKPVRRRSRASKKTPTTLVNASISNFRAVVQQYTGC-HTCPINNQKGPINLSFGSQENSS 139
            
BLAST of Fraxinus_pennsylvanica_120313_comp100093_c0_seq1 vs. UNIPROT/TREMBL
Match: B9GYA2_POPTR (B9GYA2_POPTR)

HSP 1 Score: 70.0922 bits (170), Expect = 4.298e-12
Identity = 56/142 (39.44%), Postives = 74/142 (52.11%), Query Frame = -3
              Query:  287 MSDHVPS-SSPWEQYYQEPILIDDFFMPCPEFSDATMVSTTNFDINENLFNPDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNAHITNFRSLVQKHTGC---------SHTQRGPITLCFGSSSS 682 MSD + S SS W Q YQ+   I         FSDAT+V+ T+   ++N+ NP+ S +        +SST    L  +     P  RRSRAS+ TP T +NA   NFR+LVQ+ TGC         SH  +GPI L FG  S+
              Sbjct:    1 MSDTMASQSSDWVQLYQQGS-IHGQATSSFVFSDATIVNVTS-GASDNIINPNSSSI--------TSSTGDQRLTPQGCVSKPVTRRSRASKKTPATLINASTANFRALVQQFTGCPPSTSISFGSH--KGPINLNFGLGSA 130
            
Match NameStatsDescription
M5WK99_PRUPEE-Value: 2.672e-14, PID: 36.57M5WK99_PRUPE[more]
G7INF7_MEDTRE-Value: 4.627e-14, PID: 39.55G7INF7_MEDTR[more]
I3SJD8_MEDTRE-Value: 1.668e-13, PID: 38.81I3SJD8_MEDTR[more]
M1AK30_SOLTUE-Value: 8.019e-13, PID: 37.67M1AK30_SOLTU[more]
B9MUN3_POPTRE-Value: 1.507e-12, PID: 40.88B9MUN3_POPTR[more]
A0A0B2QYJ0_GLYSOE-Value: 1.513e-12, PID: 36.08A0A0B2QYJ0_GLYSO[more]
I1L165_SOYBNE-Value: 1.825e-12, PID: 35.44I1L165_SOYBN[more]
K4B7H9_SOLLCE-Value: 1.827e-12, PID: 55.22K4B7H9_SOLLC[more]
K4B5E5_SOLLCE-Value: 3.154e-12, PID: 50.63K4B5E5_SOLLC[more]
B9GYA2_POPTRE-Value: 4.298e-12, PID: 39.44B9GYA2_POPTR[more]
back to top
Expression

Select an Expression Analysis

Select a property to group and sort biological samples

Select a property to color biological samples

Hover the mouse over a column in the graph to view more information about that biological sample. You can click and drag to rearrange groups along the x-axis. You can also click and drag to move the legend.

Only Non-Zero Values | Reset

Download expression dataset for this feature
Synonyms
JBrowse

The Green ash (F. pennsylvanica) transcriptome was mapped to the European ash (F. excelsior) genome assembly using GMAP.

Total F. pennsylvanica mrna contigs Contigs mapped to F. excelsior >90% identity >90% coverage
107,611 102,977 80,940 75,379

Reference: Thomas D. Wu and Colin K. Watanabe. GMAP: a genomic mapping and alignment program for mRNA and EST sequences. Bioinformatics 2005 21:1859-1875

Go to JBrowse